PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g33801.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 384aa    MW: 45004.4 Da    PI: 9.9835
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g33801.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR137.48.6e-1229734591
              FAR1 45 kkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                      +   +k r++++ + t+C+ak++v++++ ++w vt++e +HnH+l+p
  Bradi1g33801.1.p 29 QG--KKPRKKNTIEITDCQAKMVVTLKEGDRWIVTSFEMQHNHALSP 73
                      33..47899999********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.1E-102973IPR004330FAR1 DNA binding domain
PfamPF105514.1E-33193287IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MTLKYTCRTS LLLHLSQVVR KSGLTHAVQG KKPRKKNTIE ITDCQAKMVV TLKEGDRWIV  60
TSFEMQHNHA LSPPGEAKYL RSHKHMTDHE KLLIRTLNSV KLPTRKIMTI LAVIRGGLSA  120
VPFTKKDVSN YKTAIRNETN QNDMMMVLDY FRKRQMQDPQ FYYAFKVGDE SKVENIFWVD  180
GNSRRFYQLY GDCISFDTTY RTNMYNLPFA PFVGVTGHAN NCLFACAILQ NETIDTFTWL  240
FQEFLLCMGG KMPQTIITDQ DVAMKHAIPK VFKKTTHRNC LFHIKKKAEE KCARCFATKK  300
MLHLEFNDVI NRSQTEEEFE SLWPAMLRKY NVEHIKYFQQ MWEMRKQFVP VYFKKDFSPS  360
YTRQQGVRAQ MLYSKIMLDQ HIA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752565.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_014752566.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_014752567.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_014752568.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
TrEMBLA0A0Q3ISG80.0A0A0Q3ISG8_BRADI; Uncharacterized protein (Fragment)
STRINGLOC_Os06g36970.11e-132(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-78FAR1-related sequence 5